Lineage for d1rkla_ (1rkl A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631718Superfamily f.23.30: Oligosaccharyltransferase subunit ost4p [103464] (1 family) (S)
    automatically mapped to Pfam PF10215
  5. 2631719Family f.23.30.1: Oligosaccharyltransferase subunit ost4p [103465] (2 proteins)
  6. 2631720Protein Oligosaccharyltransferase subunit ost4p [103466] (1 species)
  7. 2631721Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103467] (1 PDB entry)
  8. 2631722Domain d1rkla_: 1rkl A: [97615]

Details for d1rkla_

PDB Entry: 1rkl (more details)

PDB Description: nmr structure of yeast oligosaccharyltransferase subunit ost4p
PDB Compounds: (A:) Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit

SCOPe Domain Sequences for d1rkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkla_ f.23.30.1 (A:) Oligosaccharyltransferase subunit ost4p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
misdeqlnslaitfgivmmtliviyhavdstmspkn

SCOPe Domain Coordinates for d1rkla_:

Click to download the PDB-style file with coordinates for d1rkla_.
(The format of our PDB-style files is described here.)

Timeline for d1rkla_: