Lineage for d1rkea2 (1rke A:129-258)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700113Protein Vinculin [47224] (2 species)
  7. 2700127Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
    Uniprot P18206 1-257
  8. 2700141Domain d1rkea2: 1rke A:129-258 [97609]
    Other proteins in same PDB: d1rkea3
    head domain; contains two domains of this fold; complexed with separate tail domain of the same or closely related protein

Details for d1rkea2

PDB Entry: 1rke (more details), 2.35 Å

PDB Description: Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d1rkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkea2 a.24.9.1 (A:129-258) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswdedaw

SCOPe Domain Coordinates for d1rkea2:

Click to download the PDB-style file with coordinates for d1rkea2.
(The format of our PDB-style files is described here.)

Timeline for d1rkea2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rkeb_