Lineage for d1rk2b_ (1rk2 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872417Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 1872480Protein Ribokinase [53615] (3 species)
  7. 1872481Species Escherichia coli [TaxId:562] [53616] (5 PDB entries)
  8. 1872485Domain d1rk2b_: 1rk2 B: [34931]
    complexed with adp, alf, mg, rib

Details for d1rk2b_

PDB Entry: 1rk2 (more details), 2.25 Å

PDB Description: e. coli ribokinase complexed with ribose and adp, solved in space group p212121
PDB Compounds: (B:) ribokinase

SCOPe Domain Sequences for d1rk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk2b_ c.72.1.1 (B:) Ribokinase {Escherichia coli [TaxId: 562]}
qnagslvvlgsinadhilnlqsfptpgetvtgnhyqvafggkganqavaagrsganiafi
actgddsigesvrqqlatdniditpvsvikgestgvalifvngegenvigihaganaals
palveaqrerianasallmqlesplesvmaaakiahqnktivalnpaparelpdellalv
diitpneteaekltgirvendedaakaaqvlhekgirtvlitlgsrgvwasvngegqrvp
gfrvqavdtiaagdtfngalitalleekplpeairfahaaaaiavtrkgaqpsvpwreei
dafldrq

SCOPe Domain Coordinates for d1rk2b_:

Click to download the PDB-style file with coordinates for d1rk2b_.
(The format of our PDB-style files is described here.)

Timeline for d1rk2b_: