Lineage for d1rj5b_ (1rj5 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
single sheet; 10 strandsSuperfamily b.74.1: Carbonic anhydrase [51069] (2 families) 
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
automatically mapped to Pfam PF00194Protein Carbonic anhydrase [51071] (10 species) 
Species Mouse (Mus musculus), isozyme XIV [TaxId:10090] [101945] (2 PDB entries) 
Domain d1rj5b_: 1rj5 B: [97532]
extracellular domain
complexed with acy, cl, zn
Details for d1rj5b_
PDB Entry: 1rj5 (more details), 2.81 Å
PDB Description: crystal structure of the extracellular domain of murine carbonic anhydrase xiv
PDB Compounds: (B:) Carbonic anhydrase XIVSCOPe Domain Sequences for d1rj5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rj5b_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]}
wtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldlhn
nghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhyds
qsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvrel
fpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpseplvq
nyrvpqplnqrtifasf
SCOPe Domain Coordinates for d1rj5b_:
Click to download the PDB-style file with coordinates for d1rj5b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rj5b_:
- d1rj5b_ first appeared in SCOP 1.67
- d1rj5b_ appears in SCOPe 2.07
View in 3D
