Lineage for d1rj1a_ (1rj1 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767650Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 767651Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (2 proteins)
    Pfam PF04043
  6. 767652Protein Invertase inhibitor [101150] (1 species)
  7. 767653Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (7 PDB entries)
  8. 767657Domain d1rj1a_: 1rj1 A: [97526]

Details for d1rj1a_

PDB Entry: 1rj1 (more details), 1.87 Å

PDB Description: Crystal Structure of a Cell Wall Invertase Inhibitor from Tobacco
PDB Compounds: (A:) invertase inhibitor

SCOP Domain Sequences for d1rj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj1a_ a.29.6.1 (A:) Invertase inhibitor {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
gnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrh
snppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfk
gskspfsalniavhelsdvgraivrnll

SCOP Domain Coordinates for d1rj1a_:

Click to download the PDB-style file with coordinates for d1rj1a_.
(The format of our PDB-style files is described here.)

Timeline for d1rj1a_: