Lineage for d1rioh_ (1rio H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309198Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2309233Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 2309241Protein Sigma70 (SigA, RpoD) [88666] (4 species)
    Pfam PF03979
  7. 2309250Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries)
  8. 2309252Domain d1rioh_: 1rio H: [97515]
    Other proteins in same PDB: d1rioa1, d1rioa2, d1riob1, d1riob2
    protein/DNA complex; complexed with ca, mpd

Details for d1rioh_

PDB Entry: 1rio (more details), 2.3 Å

PDB Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA
PDB Compounds: (H:) sigma factor sigA

SCOPe Domain Sequences for d1rioh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rioh_ a.4.13.2 (H:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]}
seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky
h

SCOPe Domain Coordinates for d1rioh_:

Click to download the PDB-style file with coordinates for d1rioh_.
(The format of our PDB-style files is described here.)

Timeline for d1rioh_: