Lineage for d1rhwa_ (1rhw A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551753Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2551754Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2551755Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2551756Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 2551757Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (14 PDB entries)
  8. 2551787Domain d1rhwa_: 1rhw A: [97490]

Details for d1rhwa_

PDB Entry: 1rhw (more details)

PDB Description: the solution structure of the ph-induced monomer of dynein light chain lc8 from drosophila
PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d1rhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhwa_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d1rhwa_:

Click to download the PDB-style file with coordinates for d1rhwa_.
(The format of our PDB-style files is described here.)

Timeline for d1rhwa_: