Lineage for d1rh8a_ (1rh8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382667Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2382687Protein Piccolo [101566] (1 species)
  7. 2382688Species Norway rat (Rattus norvegicus) [TaxId:10116] [101567] (1 PDB entry)
  8. 2382689Domain d1rh8a_: 1rh8 A: [97467]
    first C2 domain

Details for d1rh8a_

PDB Entry: 1rh8 (more details)

PDB Description: three-dimensional structure of the calcium-free piccolo c2a-domain
PDB Compounds: (A:) Piccolo protein

SCOPe Domain Sequences for d1rh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh8a_ b.7.1.2 (A:) Piccolo {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ashpitgeiqlqinydlgnliihilqarnlvprdnngysdpfvkvyllpgrgqvmvvqna
saeykrrtkyvqkslnpewnqtviyksismeqlmkktlevtvwdydrfssndflgevlid
lsstshldntprwyplkeqtes

SCOPe Domain Coordinates for d1rh8a_:

Click to download the PDB-style file with coordinates for d1rh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rh8a_: