Lineage for d1rfua_ (1rfu A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2154413Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2154414Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2154627Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2154628Protein Pyridoxal kinase [82516] (1 species)
  7. 2154629Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries)
  8. 2154639Domain d1rfua_: 1rfu A: [97401]
    complexed with adp, plp, zn

Details for d1rfua_

PDB Entry: 1rfu (more details), 2.8 Å

PDB Description: Crystal structure of pyridoxal kinase complexed with ADP and PLP
PDB Compounds: (A:) Pyridoxal kinase

SCOPe Domain Sequences for d1rfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfua_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}
meeecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsd
elqelydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqr
ngegamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgp
dtvvitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaam
llawthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdi
espeivvqatvl

SCOPe Domain Coordinates for d1rfua_:

Click to download the PDB-style file with coordinates for d1rfua_.
(The format of our PDB-style files is described here.)

Timeline for d1rfua_: