Lineage for d1rfna_ (1rfn A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953355Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 953356Species Human (Homo sapiens) [TaxId:9606] [50585] (5 PDB entries)
  8. 953362Domain d1rfna_: 1rfn A: [26354]
    Other proteins in same PDB: d1rfnb_
    complexed with ca, pbz, tbu

Details for d1rfna_

PDB Entry: 1rfn (more details), 2.8 Å

PDB Description: human coagulation factor ixa in complex with p-amino benzamidine
PDB Compounds: (A:) protein (coagulation factor ix)

SCOPe Domain Sequences for d1rfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d1rfna_:

Click to download the PDB-style file with coordinates for d1rfna_.
(The format of our PDB-style files is described here.)

Timeline for d1rfna_: