Lineage for d1rf4a_ (1rf4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957100Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2957101Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (4 species)
  7. 2957128Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [103061] (3 PDB entries)
  8. 2957133Domain d1rf4a_: 1rf4 A: [97358]
    complexed with spq

Details for d1rf4a_

PDB Entry: 1rf4 (more details), 2.2 Å

PDB Description: Structural Studies of Streptococcus pneumoniae EPSP Synthase, Tetrahedral intermediate Bound State
PDB Compounds: (A:) 5-enolpyruvylshikimate-3-phosphate synthase

SCOPe Domain Sequences for d1rf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf4a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mklktnirhlhgiirvpgdksishrsiifgslaegetkvydilrgedvlstmqvfrdlgv
eiedkdgvitvqgvgmaglkapqnalnmgnsgtsirlisgvlagadfevemfgddslskr
pmdrvtlplkkmgvsisgqterdlpplrlkgtknlrpihyelpiasaqvksalmfaalqa
kgesviiekeytrnhtedmlqqfgghlsvdgkkitvqgpqkltgqkvvvpgdissaafwl
vagliapnsrlvlqnvginetrtgiidviramggkleiteidpvaksatlivessdlkgt
eicgaliprlidelpiiallatqaqgvtvikdaeelkvketdriqvvadalnsmgaditp
tadgmiikgksalhgarvntfgdhrigmmtaiaallvadgeveldraeaintsypsffdd
leslihg

SCOPe Domain Coordinates for d1rf4a_:

Click to download the PDB-style file with coordinates for d1rf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1rf4a_: