Lineage for d1rc7a1 (1rc7 A:1-150)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100519Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1100520Superfamily a.149.1: RNase III domain-like [69065] (2 families) (S)
  5. 1100521Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 1100525Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 1100526Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 1100531Domain d1rc7a1: 1rc7 A:1-150 [97289]
    Other proteins in same PDB: d1rc7a2
    protein/RNA complex; complexed with trs; mutant

Details for d1rc7a1

PDB Entry: 1rc7 (more details), 2.15 Å

PDB Description: crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with ds-rna at 2.15 angstrom resolution
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1rc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc7a1 a.149.1.1 (A:1-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyids
grdanftrelfyklfkedilsaikegrvkk

SCOPe Domain Coordinates for d1rc7a1:

Click to download the PDB-style file with coordinates for d1rc7a1.
(The format of our PDB-style files is described here.)

Timeline for d1rc7a1:

1100531
d1rc7a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1rc7a2