Lineage for d1ra6a_ (1ra6 A:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743413Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 743421Protein Viral RNA polymerase [56695] (9 species)
  7. 743485Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
  8. 743486Domain d1ra6a_: 1ra6 A: [104879]
    complexed with acy, cas; mutant

Details for d1ra6a_

PDB Entry: 1ra6 (more details), 2 Å

PDB Description: poliovirus polymerase full length apo structure
PDB Compounds: (A:) Genome polyprotein

SCOP Domain Sequences for d1ra6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ra6a_ e.8.1.4 (A:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

SCOP Domain Coordinates for d1ra6a_:

Click to download the PDB-style file with coordinates for d1ra6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ra6a_: