Lineage for d1r9ga_ (1r9g A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
contains a catalytic Cys-His-Glu triad
Protein Hypothetical protein YaaE [102250] (4 species)
glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesisSpecies Bacillus subtilis [TaxId:1423] [102251] (2 PDB entries) 
Domain d1r9ga_: 1r9g A: [97258]
Details for d1r9ga_
PDB Entry: 1r9g (more details), 2.5 Å
PDB Description: Three-dimensional Structure of YaaE from Bacillus subtilis
PDB Compounds: (A:) Hypothetical protein yaaESCOPe Domain Sequences for d1r9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9ga_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt
qlfvemveeykqkalv
SCOPe Domain Coordinates for d1r9ga_:
Click to download the PDB-style file with coordinates for d1r9ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r9ga_:
- d1r9ga_ first appeared in SCOP 1.67
- d1r9ga_ appears in SCOPe 2.06
- d1r9ga_ appears in the current release, SCOPe 2.08
View in 3D
