Lineage for d1r9ca_ (1r9c A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1023239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1023274Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 1023320Protein Fosfomycin resistance protein FosX [102872] (1 species)
  7. 1023321Species Mesorhizobium loti [TaxId:381] [102873] (1 PDB entry)
  8. 1023322Domain d1r9ca_: 1r9c A: [97255]
    complexed with mn

Details for d1r9ca_

PDB Entry: 1r9c (more details), 1.83 Å

PDB Description: Crystal Structure of Fosfomycin Resistance Protein FosX from Mesorhizobium Loti
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d1r9ca_:

Sequence, based on SEQRES records: (download)

>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasdteqfslsrekffligdiwvaimqge
klaersynhiafkiddadfdryaervgklgldmrpprprvegegrsiyfydddnhmfelh
tgtlterlar

Sequence, based on observed residues (ATOM records): (download)

>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasdteqfslsrekffligdiwvaimqge
klaersynhiafkiddadfdryaervgklgldmrpprpgrsiyfydddnhmfelhtgtlt
erlar

SCOPe Domain Coordinates for d1r9ca_:

Click to download the PDB-style file with coordinates for d1r9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1r9ca_: