Lineage for d1r9ca_ (1r9c A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
duplication: consists of two clear structural repeats each having this fold
subunit fold and dimeric assembly are similar to those of glyoxalase
Protein Fosfomycin resistance protein FosX [102872] (1 species) Species Mesorhizobium loti [TaxId:381] [102873] (1 PDB entry) 
Domain d1r9ca_: 1r9c A: [97255]
complexed with mn
Details for d1r9ca_
PDB Entry: 1r9c (more details), 1.83 Å
PDB Description: Crystal Structure of Fosfomycin Resistance Protein FosX from Mesorhizobium Loti
PDB Compounds: (A:) glutathione transferaseSCOPe Domain Sequences for d1r9ca_:
Sequence, based on SEQRES records: (download)
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasdteqfslsrekffligdiwvaimqge
klaersynhiafkiddadfdryaervgklgldmrpprprvegegrsiyfydddnhmfelh
tgtlterlar
Sequence, based on observed residues (ATOM records): (download)
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasdteqfslsrekffligdiwvaimqge
klaersynhiafkiddadfdryaervgklgldmrpprpgrsiyfydddnhmfelhtgtlt
erlar
SCOPe Domain Coordinates for d1r9ca_:
Click to download the PDB-style file with coordinates for d1r9ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r9ca_:
- d1r9ca_ first appeared in SCOP 1.67
- d1r9ca_ appears in SCOPe 2.07
View in 3D
