Lineage for d1r8ub_ (1r8u B:)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.53: TAZ domain [57932] (1 superfamily)
all-alpha fold; Zn-binding sites are in the loops connecting helicesSuperfamily g.53.1: TAZ domain [57933] (1 family) 
automatically mapped to Pfam PF02135Family g.53.1.1: TAZ domain [57934] (2 proteins) Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [57936] (6 PDB entries) 
Domain d1r8ub_: 1r8u B: [97250]
Other proteins in same PDB: d1r8ua_
CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A)
complexed with zn
Details for d1r8ub_
PDB Entry: 1r8u (more details)
PDB Description: nmr structure of cbp taz1/cited2 complex
PDB Compounds: (B:) creb-binding proteinSCOPe Domain Sequences for d1r8ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8ub_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus) [TaxId: 10090]}
atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
gkacqvahcassrqiishwknctrhdcpvclplknasdkr
SCOPe Domain Coordinates for d1r8ub_:
Click to download the PDB-style file with coordinates for d1r8ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r8ub_:
- d1r8ub_ first appeared in SCOP 1.67
- d1r8ub_ appears in SCOPe 2.06
- d1r8ub_ appears in the current release, SCOPe 2.08
View in 3D
