Lineage for d1r8pa_ (1r8p A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909140Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 1909141Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 1909148Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 1909156Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries)
    Uniprot P03120 286-365
  8. 1909162Domain d1r8pa_: 1r8p A: [111720]

Details for d1r8pa_

PDB Entry: 1r8p (more details)

PDB Description: hpv-16 e2c solution structure
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1r8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8pa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi

SCOPe Domain Coordinates for d1r8pa_:

Click to download the PDB-style file with coordinates for d1r8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1r8pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r8pb_