Lineage for d1r8da_ (1r8d A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is differentSuperfamily a.6.1: Putative DNA-binding domain [46955] (8 families) 
Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
includes a dimerisation, antiparallel coiled-coil subdomain
Protein Multidrug transporter activator MtaN [68976] (1 species) Species Bacillus subtilis [TaxId:1423] [68977] (2 PDB entries)
Uniprot P71039 1-109
Domain d1r8da_: 1r8d A: [104841]
protein/DNA complex; complexed with so4
Details for d1r8da_
PDB Entry: 1r8d (more details), 2.7 Å
PDB Description: Crystal Structure of MtaN Bound to DNA
PDB Compounds: (A:) transcription activator MtaNSCOPe Domain Sequences for d1r8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]}
mkyqvkqvaeisgvsirtlhhydniellnpsaltdagyrlysdadlerlqqilffkeigf
rldeikemldhpnfdrkaalqsqkeilmkkkqrmdemiqtidrtllsvd
SCOPe Domain Coordinates for d1r8da_:
Click to download the PDB-style file with coordinates for d1r8da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r8da_:
- d1r8da_ first appeared in SCOP 1.69
- d1r8da_ appears in SCOPe 2.07
View in 3D
