Lineage for d1r89a3 (1r89 A:258-437)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029088Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 1029104Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (1 protein)
    decorated fold with a large insertion
  6. 1029105Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 1029106Species Archaeoglobus fulgidus [TaxId:2234] [102997] (28 PDB entries)
    Uniprot O28126
  8. 1029107Domain d1r89a3: 1r89 A:258-437 [97223]
    Other proteins in same PDB: d1r89a1, d1r89a2
    complexed with cl, ctp, mg, mn, na

Details for d1r89a3

PDB Entry: 1r89 (more details), 1.8 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide Complexes
PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1r89a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r89a3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d1r89a3:

Click to download the PDB-style file with coordinates for d1r89a3.
(The format of our PDB-style files is described here.)

Timeline for d1r89a3: