Lineage for d1r7ja_ (1r7j A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694214Family a.4.5.49: Archaeal DNA-binding protein [109677] (1 protein)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers
  6. 2694215Protein Sso10a (SSO10449) [109678] (1 species)
  7. 2694216Species Sulfolobus solfataricus [TaxId:2287] [109679] (2 PDB entries)
    Uniprot Q5W1E8
  8. 2694217Domain d1r7ja_: 1r7j A: [104836]

Details for d1r7ja_

PDB Entry: 1r7j (more details), 1.47 Å

PDB Description: Crystal structure of the DNA-binding protein Sso10a from Sulfolobus solfataricus
PDB Compounds: (A:) Conserved hypothetical protein Sso10a

SCOPe Domain Sequences for d1r7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]}
kkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymltkk
geelledirkfnemrknmdqlkekinsvls

SCOPe Domain Coordinates for d1r7ja_:

Click to download the PDB-style file with coordinates for d1r7ja_.
(The format of our PDB-style files is described here.)

Timeline for d1r7ja_: