Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.49: Archaeal DNA-binding protein [109677] (1 protein) contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers |
Protein Sso10a (SSO10449) [109678] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [109679] (2 PDB entries) Uniprot Q5W1E8 |
Domain d1r7ja_: 1r7j A: [104836] |
PDB Entry: 1r7j (more details), 1.47 Å
SCOPe Domain Sequences for d1r7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]} kkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymltkk geelledirkfnemrknmdqlkekinsvls
Timeline for d1r7ja_: