| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Glutaredoxin-like NRDH-redoxin [64052] (3 species) |
| Species Corynebacterium ammoniagenes [TaxId:1697] [102432] (1 PDB entry) |
| Domain d1r7ha_: 1r7h A: [97196] segment-swapped dimer |
PDB Entry: 1r7h (more details), 2.69 Å
SCOPe Domain Sequences for d1r7ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]}
msitlytkpacvqctatkkaldraglayntvdislddeardyvmalgyvqapvvevdgeh
wsgfrperikqlqa
Timeline for d1r7ha_: