SCOPe 2.08: Domain d1r72e3: 1r72 E:1-77

Lineage for d1r72e3 (1r72 E:1-77)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
contains a small beta-sheet (wing)
Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
AT-rich DNA-binding protein p25
Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
Uniprot Q9X2V5; # CASP5
Domain d1r72e3: 1r72 E:1-77 [302978]
Other proteins in same PDB: d1r72a4, d1r72b4, d1r72c4, d1r72d4, d1r72e4, d1r72f4, d1r72g4
automated match to d1xcba1
complexed with ca, mg, nad

Details for d1r72e3

PDB Entry: 1r72 (more details), 2.9 Å

PDB Description: Crystal Structure of p25 from Thermus aquaticus

PDB Compounds: (E:) AT-rich DNA-binding protein p25

SCOPe Domain Sequences for d1r72e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r72e3 a.4.5.38 (E:1-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
gytvpvlkrelrhilgl

SCOPe Domain Coordinates for d1r72e3:

Click to download the PDB-style file with coordinates for d1r72e3.
(The format of our PDB-style files is described here.)

Timeline for d1r72e3: