Lineage for d1r6la2 (1r6l A:152-239)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) 
Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins) 
Protein Ribonuclease PH, domain 2 [103150] (4 species) 
Species Pseudomonas aeruginosa [TaxId:287] [103152] (2 PDB entries) 
Domain d1r6la2: 1r6l A:152-239 [97154]
Other proteins in same PDB: d1r6la1
complexed with nhe, so4
Details for d1r6la2
PDB Entry: 1r6l (more details), 1.9 Å
PDB Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa
PDB Compounds: (A:) Ribonuclease PHSCOPe Domain Sequences for d1r6la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]}
kgnplkqmvaavsvgiyqgvpvldldyledsaaetdlnvvmtdaggfievqgtaegapfr
paelnamlelaqqgmqelfelqraalae
SCOPe Domain Coordinates for d1r6la2:
Click to download the PDB-style file with coordinates for d1r6la2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r6la2:
- d1r6la2 first appeared in SCOP 1.67
- d1r6la2 appears in SCOPe 2.03
- d1r6la2 appears in SCOPe 2.05
- d1r6la2 appears in the current release, SCOPe 2.08
View in 3D
