Lineage for d1r5ra_ (1r5r A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 769304Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 769305Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 769341Protein Pheromone-binding protein asp1 [101192] (1 species)
  7. 769342Species Common honeybee (Apis mellifera) [TaxId:7460] [101193] (1 PDB entry)
  8. 769343Domain d1r5ra_: 1r5r A: [97104]
    complexed with nbb

Details for d1r5ra_

PDB Entry: 1r5r (more details), 1.6 Å

PDB Description: Soft-SAD crystal structure of a pheromone binding protein from the honeybee Apis mellifera L.
PDB Compounds: (A:) Pheromone-binding protein ASP1

SCOP Domain Sequences for d1r5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ra_ a.39.2.1 (A:) Pheromone-binding protein asp1 {Common honeybee (Apis mellifera) [TaxId: 7460]}
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

SCOP Domain Coordinates for d1r5ra_:

Click to download the PDB-style file with coordinates for d1r5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1r5ra_: