Lineage for d1r5aa2 (1r5a A:2-86)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) 
Protein Class delta GST [81366] (6 species)
formerly a part of class theta enzymes
Species Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId:123217] [102439] (1 PDB entry) 
Domain d1r5aa2: 1r5a A:2-86 [97082]
Other proteins in same PDB: d1r5aa1
complexed with cu, gts
Details for d1r5aa2
PDB Entry: 1r5a (more details), 2.5 Å
PDB Description: Glutathione S-transferase
PDB Compounds: (A:) glutathione transferaseSCOPe Domain Sequences for d1r5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}
ttvlyylpasppcrsvlllakmigveldlkvlnimegeqlkpdfvelnpqhciptmddhg
lvlwesrvilsylvsaygkdenlyp
SCOPe Domain Coordinates for d1r5aa2:
Click to download the PDB-style file with coordinates for d1r5aa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r5aa2:
- d1r5aa2 first appeared in SCOP 1.67
- d1r5aa2 appears in SCOPe 2.05
- d1r5aa2 appears in SCOPe 2.07
- d1r5aa2 appears in the current release, SCOPe 2.08
View in 3D
