Lineage for d1r5aa1 (1r5a A:87-215)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class delta GST [81355] (6 species)
formerly a part of class theta enzymes
Species Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId:123217] [101207] (1 PDB entry) 
Domain d1r5aa1: 1r5a A:87-215 [97081]
Other proteins in same PDB: d1r5aa2
complexed with cu, gts
Details for d1r5aa1
PDB Entry: 1r5a (more details), 2.5 Å
PDB Description: Glutathione S-transferase
PDB Compounds: (A:) glutathione transferaseSCOPe Domain Sequences for d1r5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}
kdfrsraivdqrlhfdlgtlyqrvvdyyfptihlgahldqtkkaklaealgwfeamlkqy
qwsaanhftiadialcvtvsqieafqfdlhpyprvrawllkckdeleghgykeinetgae
tlaglfrsk
SCOPe Domain Coordinates for d1r5aa1:
Click to download the PDB-style file with coordinates for d1r5aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r5aa1:
- d1r5aa1 first appeared in SCOP 1.67
- d1r5aa1 appears in SCOPe 2.07
View in 3D
