Lineage for d1r58a2 (1r58 A:110-374,A:449-478)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta foldsSuperfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) Protein Methionine aminopeptidase [55924] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries)
Uniprot P50579 110-478
methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
Domain d1r58a2: 1r58 A:110-374,A:449-478 [111696]
Other proteins in same PDB: d1r58a1
complexed with ao5, mn
Details for d1r58a2
PDB Entry: 1r58 (more details), 1.9 Å
PDB Description: Crystal Structure of MetAP2 complexed with A357300
PDB Compounds: (A:) Methionine aminopeptidase 2SCOPe Domain Sequences for d1r58a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r58a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy
SCOPe Domain Coordinates for d1r58a2:
Click to download the PDB-style file with coordinates for d1r58a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r58a2:
- d1r58a2 first appeared in SCOP 1.71
- d1r58a2 appears in SCOPe 2.07
View in 3D
