SCOPe 2.07: Domain d1r56c2: 1r56 C:137-299

Lineage for d1r56c2 (1r56 C:137-299)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.96: T-fold [55619] (2 superfamilies)
beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
tunnel-shaped: its known members form wide oligomeric barrels different sizes
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
bind purine or pterin in topologically similar sites between subunits
Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
automatically mapped to Pfam PF01014
Protein Urate oxidase (uricase) [55634] (3 species)
duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)
Domain d1r56c2: 1r56 C:137-299 [97069]
complexed with peg

Details for d1r56c2

PDB Entry: 1r56 (more details), 2.3 Å

PDB Description: uncomplexed urate oxidase from aspergillus flavus

PDB Compounds: (C:) Uricase

SCOPe Domain Sequences for d1r56c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r56c2 d.96.1.4 (C:137-299) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrsslks

SCOPe Domain Coordinates for d1r56c2:

Click to download the PDB-style file with coordinates for d1r56c2.
(The format of our PDB-style files is described here.)

Timeline for d1r56c2: