Lineage for d1r4wa_ (1r4w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878767Protein Mitochondrial class kappa glutathione S-transferase [102437] (1 species)
    contains larger and less compact insertion in the common fold than DsbA
  7. 2878768Species Norway rat (Rattus norvegicus) [TaxId:10116] [102438] (1 PDB entry)
  8. 2878769Domain d1r4wa_: 1r4w A: [97050]
    complexed with gsh

Details for d1r4wa_

PDB Entry: 1r4w (more details), 2.5 Å

PDB Description: Crystal structure of Mitochondrial class kappa glutathione transferase
PDB Compounds: (A:) Glutathione S-transferase, mitochondrial

SCOPe Domain Sequences for d1r4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4wa_ c.47.1.13 (A:) Mitochondrial class kappa glutathione S-transferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpaprvlelfydvlspyswlgfevlcryqhlwniklklrpallagimkdsgnqppamvph
kgqyilkeipllkqlfqvpmsvpkdffgehvkkgtvnamrfltavsmeqpemlekvsrel
wmriwsrdeditesqnilsaaekagmataqaqhllnkistelvksklrettgaackygaf
glpttvahvdgktymlfgsdrmellayllgekwmgpvpptl

SCOPe Domain Coordinates for d1r4wa_:

Click to download the PDB-style file with coordinates for d1r4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1r4wa_: