Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
Protein Mitochondrial class kappa glutathione S-transferase [102437] (1 species) contains larger and less compact insertion in the common fold than DsbA |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [102438] (1 PDB entry) |
Domain d1r4wa_: 1r4w A: [97050] complexed with gsh |
PDB Entry: 1r4w (more details), 2.5 Å
SCOPe Domain Sequences for d1r4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4wa_ c.47.1.13 (A:) Mitochondrial class kappa glutathione S-transferase {Norway rat (Rattus norvegicus) [TaxId: 10116]} gpaprvlelfydvlspyswlgfevlcryqhlwniklklrpallagimkdsgnqppamvph kgqyilkeipllkqlfqvpmsvpkdffgehvkkgtvnamrfltavsmeqpemlekvsrel wmriwsrdeditesqnilsaaekagmataqaqhllnkistelvksklrettgaackygaf glpttvahvdgktymlfgsdrmellayllgekwmgpvpptl
Timeline for d1r4wa_: