Lineage for d1r4sa2 (1r4s A:137-296)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.96: T-fold [55619] (2 superfamilies)
beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
tunnel-shaped: its known members form wide oligomeric barrels different sizesSuperfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) 
bind purine or pterin in topologically similar sites between subunitsFamily d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
automatically mapped to Pfam PF01014Protein Urate oxidase (uricase) [55634] (3 species)
duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries) 
Domain d1r4sa2: 1r4s A:137-296 [97046]
complexed with cys, mua
Details for d1r4sa2
PDB Entry: 1r4s (more details), 1.8 Å
PDB Description: urate oxidase from aspergillus flavus complexed with its inhibitor 9- methyl uric acid
PDB Compounds: (A:) UricaseSCOPe Domain Sequences for d1r4sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4sa2 d.96.1.4 (A:137-296) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrss
SCOPe Domain Coordinates for d1r4sa2:
Click to download the PDB-style file with coordinates for d1r4sa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r4sa2:
- d1r4sa2 first appeared in SCOP 1.67
- d1r4sa2 appears in SCOPe 2.07
View in 3D
