Lineage for d1r4sa1 (1r4s A:1-136)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.96: T-fold [55619] (2 superfamilies)
beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
tunnel-shaped: its known members form wide oligomeric barrels different sizesSuperfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) 
bind purine or pterin in topologically similar sites between subunits
Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein) Protein Urate oxidase (uricase) [55634] (3 species)
duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16Species Aspergillus flavus [TaxId:5059] [55635] (22 PDB entries) 
Domain d1r4sa1: 1r4s A:1-136 [97045]
complexed with mua, scc
Details for d1r4sa1
PDB Entry: 1r4s (more details), 1.8 Å
PDB Description: urate oxidase from aspergillus flavus complexed with its inhibitor 9- methyl uric acid
PDB Compounds: (A:) UricaseSCOPe Domain Sequences for d1r4sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4sa1 d.96.1.4 (A:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve
SCOPe Domain Coordinates for d1r4sa1:
Click to download the PDB-style file with coordinates for d1r4sa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r4sa1:
- d1r4sa1 first appeared in SCOP 1.67
- d1r4sa1 appears in SCOP 1.75
- d1r4sa1 appears in SCOPe 2.02
- d1r4sa1 appears in the current release, SCOPe 2.08
View in 3D
