Lineage for d1r3ub_ (1r3u B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.61.1: PRTase-like [53271] (3 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) 
Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species) 
Species Thermoanaerobacter tengcongensis [TaxId:119072] [117671] (1 PDB entry)
Uniprot Q8R7L0
Domain d1r3ub_: 1r3u B: [111682]
complexed with act, mg
Details for d1r3ub_
PDB Entry: 1r3u (more details), 2.5 Å
PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis
PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferaseSCOPe Domain Sequences for d1r3ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3ub_ c.61.1.1 (B:) Hypoxanthine-guanine PRTase (HGPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]}
spmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlpl
sidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrkp
rslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely
SCOPe Domain Coordinates for d1r3ub_:
Click to download the PDB-style file with coordinates for d1r3ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r3ub_:
- d1r3ub_ first appeared in SCOP 1.71
- d1r3ub_ appears in SCOPe 2.07
View in 3D
