Lineage for d1r3fa1 (1r3f A:251-314)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.122: PUA domain-like [88696] (1 superfamily)
pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each otherSuperfamily b.122.1: PUA domain-like [88697] (14 families) 
Family b.122.1.1: PUA domain [88698] (6 proteins)
RNA-binding domain
Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species) Species Escherichia coli [TaxId:562] [88700] (3 PDB entries) 
Domain d1r3fa1: 1r3f A:251-314 [96909]
Other proteins in same PDB: d1r3fa2
protein/RNA complex
Details for d1r3fa1
PDB Entry: 1r3f (more details), 1.85 Å
PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit
PDB Compounds: (A:) tRNA pseudouridine synthase BSCOPe Domain Sequences for d1r3fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3fa1 b.122.1.1 (A:251-314) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli [TaxId: 562]}
ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv
eypa
SCOPe Domain Coordinates for d1r3fa1:
Click to download the PDB-style file with coordinates for d1r3fa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r3fa1:
- d1r3fa1 first appeared in SCOP 1.67
- d1r3fa1 appears in SCOPe 2.06
- d1r3fa1 appears in the current release, SCOPe 2.08
View in 3D
