Lineage for d1r3fa1 (1r3f A:251-314)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. Species Escherichia coli [TaxId:562] [88700] (3 PDB entries)
  8. Domain d1r3fa1: 1r3f A:251-314 [96909]
    Other proteins in same PDB: d1r3fa2
    protein/RNA complex

Details for d1r3fa1

PDB Entry: 1r3f (more details), 1.85 Å

PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1r3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3fa1 b.122.1.1 (A:251-314) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli [TaxId: 562]}
ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv
eypa

SCOPe Domain Coordinates for d1r3fa1 are not available.

Timeline for d1r3fa1:

Domains from same chain:
(mouse over for more information)
d1r3fa2