![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) ![]() |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81612] (9 PDB entries) |
![]() | Domain d1r2ya2: 1r2y A:2-134 [96890] Other proteins in same PDB: d1r2ya1, d1r2ya3 bound to 8-Oxoguanine (OxoG) containing DNA complexed with 8og, zn; mutant |
PDB Entry: 1r2y (more details), 2.34 Å
SCOP Domain Sequences for d1r2ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2ya2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya keeadrrpplael
Timeline for d1r2ya2: