Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81611] (9 PDB entries) |
Domain d1r2ya1: 1r2y A:135-228 [96889] Other proteins in same PDB: d1r2ya2, d1r2ya3 bound to 8-Oxoguanine (OxoG) containing DNA complexed with 8og, zn; mutant |
PDB Entry: 1r2y (more details), 2.34 Å
SCOP Domain Sequences for d1r2ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2ya1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas lsskeierlheemvatigeavmkggstvrtyvnt
Timeline for d1r2ya1: