Lineage for d1r2qa_ (1r2q A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475628Protein Rab5a [82399] (1 species)
  7. 2475629Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. 2475630Domain d1r2qa_: 1r2q A: [96874]
    complexed with gnp, gol, mg

Details for d1r2qa_

PDB Entry: 1r2q (more details), 1.05 Å

PDB Description: Crystal Structure of Human Rab5a GTPase Domain at 1.05 A resolution
PDB Compounds: (A:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1r2qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn

SCOPe Domain Coordinates for d1r2qa_:

Click to download the PDB-style file with coordinates for d1r2qa_.
(The format of our PDB-style files is described here.)

Timeline for d1r2qa_: