Lineage for d1r2na_ (1r2n A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries)
    Uniprot P02945 17-245
  8. Domain d1r2na_: 1r2n A: [96873]
    complexed with ret

Details for d1r2na_

PDB Entry: 1r2n (more details)

PDB Description: NMR structure of the all-trans retinal in dark-adapted Bacteriorhodopsin
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d1r2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2na_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge

SCOPe Domain Coordinates for d1r2na_ are not available.

Timeline for d1r2na_: