Lineage for d1r2ch2 (1r2c H:1-36)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
annotated by the SCOP(e) curators as 'not a true fold'
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) 
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species) Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries)
synonym: blastochloris viridis
Domain d1r2ch2: 1r2c H:1-36 [96861]
Other proteins in same PDB: d1r2cc_, d1r2ch1, d1r2cl_, d1r2cm_
complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2
Details for d1r2ch2
PDB Entry: 1r2c (more details), 2.86 Å
PDB Description: photosynthetic reaction center blastochloris viridis (atcc)
PDB Compounds: (H:) reaction center protein h chainSCOPe Domain Sequences for d1r2ch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2ch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred
SCOPe Domain Coordinates for d1r2ch2:
Click to download the PDB-style file with coordinates for d1r2ch2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r2ch2:
- d1r2ch2 first appeared in SCOP 1.67
- d1r2ch2 appears in SCOPe 2.07
View in 3D
