Lineage for d1r28a_ (1r28 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.42: POZ domain [54694] (1 superfamily)
core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143Superfamily d.42.1: POZ domain [54695] (3 families) 
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) Species Human (Homo sapiens) [TaxId:9606] [102923] (33 PDB entries) 
Domain d1r28a_: 1r28 A: [96854]
Details for d1r28a_
PDB Entry: 1r28 (more details), 2.2 Å
PDB Description: crystal structure of the b-cell lymphoma 6 (bcl6) btb domain to 2.2 angstrom
PDB Compounds: (A:) B-cell lymphoma 6 proteinSCOPe Domain Sequences for d1r28a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r28a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as
SCOPe Domain Coordinates for d1r28a_:
Click to download the PDB-style file with coordinates for d1r28a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r28a_:
- d1r28a_ first appeared in SCOP 1.67
- d1r28a_ appears in SCOPe 2.06
- d1r28a_ appears in the current release, SCOPe 2.08
View in 3D
