Lineage for d1r1da_ (1r1d A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.29: Carboxylesterase/lipase [102623] (1 protein)
automatically mapped to Pfam PF12697Protein Carboxylesterase Est [102624] (1 species) Species Bacillus stearothermophilus [TaxId:1422] [102625] (2 PDB entries)
Uniprot Q06174
Domain d1r1da_: 1r1d A: [96813]
complexed with epe
Details for d1r1da_
PDB Entry: 1r1d (more details), 2 Å
PDB Description: structure of a carboxylesterase from bacillus stearothermophilus
PDB Compounds: (A:) carboxylesteraseSCOPe Domain Sequences for d1r1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1da_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}
ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
pddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
tmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyapt
fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
dw
SCOPe Domain Coordinates for d1r1da_:
Click to download the PDB-style file with coordinates for d1r1da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r1da_:
- d1r1da_ first appeared in SCOP 1.67
- d1r1da_ appears in SCOPe 2.02
- d1r1da_ appears in SCOPe 2.04
- d1r1da_ appears in the current release, SCOPe 2.08
View in 3D
