Lineage for d1r0tb_ (1r0t B:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625500Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 625501Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 625502Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 625534Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 625546Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (31 PDB entries)
  8. 625560Domain d1r0tb_: 1r0t B: [96740]
    Other proteins in same PDB: d1r0ta_
    second domain

Details for d1r0tb_

PDB Entry: 1r0t (more details), 1.9 Å

PDB Description: Crystal structure of trypsin-second domain of the ovomucoid turkey egg white inhibitor complex

SCOP Domain Sequences for d1r0tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0tb_ g.68.1.1 (B:) Ovomucoid domains {Turkey (Meleagris gallopavo)}
vpmdcsrypnttseegkvmilcnkalnpvcgtdgvtydnecvlcahnleqgtsvgkkhdg
ec

SCOP Domain Coordinates for d1r0tb_:

Click to download the PDB-style file with coordinates for d1r0tb_.
(The format of our PDB-style files is described here.)

Timeline for d1r0tb_:

625560
d1r0tb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1r0ta_