Lineage for d1qzqa1 (1qzq A:161-350)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69817] (36 PDB entries)
  8. Domain d1qzqa1: 1qzq A:161-350 [96655]

Details for d1qzqa1

PDB Entry: 1qzq (more details), 2.4 Å

PDB Description: human tyrosyl dna phosphodiesterase
PDB Compounds: (A:) tyrosyl-DNA phosphodiesterase 1

SCOPe Domain Sequences for d1qzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzqa1 d.136.1.3 (A:161-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
gnpfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefr
kkpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvvih
tsnlihadwhqktqgiwlsplypriadgthksgespthfkadlisylmaynapslkewid
vihkhdlset

SCOPe Domain Coordinates for d1qzqa1 are not available.

Timeline for d1qzqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qzqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1qzqb1, d1qzqb2