Lineage for d1qzfa1 (1qzf A:3-180)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871772Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 1871773Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries)
    Uniprot Q5CGA3 Q27552
  8. 1871774Domain d1qzfa1: 1qzf A:3-180 [96633]
    Other proteins in same PDB: d1qzfa2, d1qzfb2, d1qzfc2, d1qzfd2, d1qzfe2
    complexed with cb3, fol, ndp, ump

Details for d1qzfa1

PDB Entry: 1qzf (more details), 2.8 Å

PDB Description: Crystal structure of DHFR-TS from Cryptosporidium hominis
PDB Compounds: (A:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1qzfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzfa1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d1qzfa1:

Click to download the PDB-style file with coordinates for d1qzfa1.
(The format of our PDB-style files is described here.)

Timeline for d1qzfa1: