Lineage for d1qz5a1 (1qz5 A:5-146)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (8 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (63 PDB entries)
Uniprot P02568 ! SQ 02568
Domain d1qz5a1: 1qz5 A:5-146 [96614]
complexed with atp, ca, kab
Details for d1qz5a1
PDB Entry: 1qz5 (more details), 1.45 Å
PDB Description: Structure of rabbit actin in complex with kabiramide C
PDB Compounds: (A:) Actin, alpha skeletal muscleSCOPe Domain Sequences for d1qz5a1:
Sequence, based on SEQRES records: (download)
>d1qz5a1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg
Sequence, based on observed residues (ATOM records): (download)
>d1qz5a1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrpdsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvai
qavlslyasg
SCOPe Domain Coordinates for d1qz5a1:
Click to download the PDB-style file with coordinates for d1qz5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qz5a1:
- d1qz5a1 first appeared in SCOP 1.67
- d1qz5a1 appears in SCOPe 2.05
- d1qz5a1 appears in SCOPe 2.07
- d1qz5a1 appears in the current release, SCOPe 2.08
View in 3D
