Lineage for d1qyca_ (1qyc A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1151917Protein Phenylcoumaran benzylic ether reductase [102140] (1 species)
  7. 1151918Species Loblolly pine (Pinus taeda) [TaxId:3352] [102141] (1 PDB entry)
  8. 1151919Domain d1qyca_: 1qyc A: [96581]

Details for d1qyca_

PDB Entry: 1qyc (more details), 2.2 Å

PDB Description: Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
PDB Compounds: (A:) phenylcoumaran benzylic ether reductase PT1

SCOPe Domain Sequences for d1qyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}
gsrsrilligatgyigrhvakasldlghptfllvrestassnsekaqllesfkasganiv
hgsiddhaslveavknvdvvistvgslqiesqvniikaikevgtvkrffpsefgndvdnv
havepaksvfevkakvrraieaegipytyvssncfagyflrslaqagltapprdkvvilg
dgnarvvfvkeedigtftikavddprtlnktlylrlpantlslnelvalwekkidktlek
ayvpeeevlkliadtpfpanisiaishsifvkgdqtnfeigpagveasqlypdvkyttvd
eylsnfv

SCOPe Domain Coordinates for d1qyca_:

Click to download the PDB-style file with coordinates for d1qyca_.
(The format of our PDB-style files is described here.)

Timeline for d1qyca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qycb_