Lineage for d1qy6a_ (1qy6 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404159Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2404354Protein V8 protease [101809] (1 species)
    glutamic acid-specific protease
  7. 2404355Species Staphylococcus aureus [TaxId:1280] [101810] (3 PDB entries)
    Uniprot P04188 69-284
  8. 2404357Domain d1qy6a_: 1qy6 A: [96574]
    complexed with k

Details for d1qy6a_

PDB Entry: 1qy6 (more details), 1.9 Å

PDB Description: Structue of V8 Protease from Staphylococcus aureus
PDB Compounds: (A:) serine protease

SCOPe Domain Sequences for d1qy6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qy6a_ b.47.1.1 (A:) V8 protease {Staphylococcus aureus [TaxId: 1280]}
vilpnndrhqitdttnghyapvtyiqveaptgtfiasgvvvgkdtlltnkhvvdathgdp
halkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnn
aetqtnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknev
igihwggvpnefngavfinenvrnflkqniedinfa

SCOPe Domain Coordinates for d1qy6a_:

Click to download the PDB-style file with coordinates for d1qy6a_.
(The format of our PDB-style files is described here.)

Timeline for d1qy6a_: