Lineage for d1qxma2 (1qxm A:149-286)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951778Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 951779Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 951805Protein Hemagglutinin component Ha1 [101784] (2 species)
  7. 951806Species Clostridium botulinum D phage [TaxId:29342] [101785] (1 PDB entry)
  8. 951808Domain d1qxma2: 1qxm A:149-286 [96534]
    complexed with edo

Details for d1qxma2

PDB Entry: 1qxm (more details), 1.7 Å

PDB Description: crystal structure of a hemagglutinin component (ha1) from type c clostridium botulinum
PDB Compounds: (A:) ha1

SCOPe Domain Sequences for d1qxma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]}
nrncklqtqlnsdrflsknlnsqiivlwqwfdssrqkwiieynetksaytlkcqennryl
twiqnsnnyvetyqstdsliqywninyldndaskyilynlqdtnrvldvynsqiangthv
ivdsyhgntnqqwiinli

SCOPe Domain Coordinates for d1qxma2:

Click to download the PDB-style file with coordinates for d1qxma2.
(The format of our PDB-style files is described here.)

Timeline for d1qxma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qxma1