Lineage for d1qxma1 (1qxm A:4-148)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) 
Family b.42.2.1: Ricin B-like [50371] (11 proteins) 
Protein Hemagglutinin component Ha1 [101784] (2 species) Species Clostridium botulinum D phage [TaxId:29342] [101785] (1 PDB entry) 
Domain d1qxma1: 1qxm A:4-148 [96533]
complexed with edo
Details for d1qxma1
PDB Entry: 1qxm (more details), 1.7 Å
PDB Description: crystal structure of a hemagglutinin component (ha1) from type c clostridium botulinum
PDB Compounds: (A:) ha1SCOPe Domain Sequences for d1qxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]}
tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
lmvstqtsssnqffkfsnciyealn
SCOPe Domain Coordinates for d1qxma1:
Click to download the PDB-style file with coordinates for d1qxma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qxma1:
- d1qxma1 first appeared in SCOP 1.67
- d1qxma1 appears in SCOP 1.75
- d1qxma1 appears in SCOPe 2.02
- d1qxma1 appears in the current release, SCOPe 2.08
View in 3D
